PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G49520.1
Common NameATWRKY48, K6M13.6, WRKY48
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WRKY
Protein Properties Length: 399aa    MW: 44725.6 Da    PI: 6.5143
Description WRKY DNA-binding protein 48
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G49520.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1079.5e-34220278159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYGqK vk+s++prsYYrCt+ gC vkk+vers++dp++v +tYeg+H+h+
  AT5G49520.1 220 LDDGYRWRKYGQKAVKNSPYPRSYYRCTTVGCGVKKRVERSSDDPSIVMTTYEGQHTHP 278
                  59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.7E-34205280IPR003657WRKY domain
SuperFamilySSF1182905.1E-30213280IPR003657WRKY domain
PROSITE profilePS5081132.73215280IPR003657WRKY domain
SMARTSM007745.5E-41220279IPR003657WRKY domain
PfamPF031062.7E-27221278IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001185developmental stageplant embryo globular stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MEKKKEEDHH HQQQQQQQKE IKNTETKIEQ EQEQEQKQEI SQASSSSNMA NLVTSSDHHP  60
LELAGNLSSI FDTSSLPFPY SYFEDHSSNN PNSFLDLLRQ DHQFASSSNS SSFSFDAFPL  120
PNNNNNTSFF TDLPLPQAES SEVVNTTPTS PNSTSVSSSS NEAANDNNSG KEVTVKDQEE  180
GDQQQEQKGT KPQLKAKKKN QKKAREARFA FLTKSDIDNL DDGYRWRKYG QKAVKNSPYP  240
RSYYRCTTVG CGVKKRVERS SDDPSIVMTT YEGQHTHPFP MTPRGHIGML TSPILDHGAT  300
TASSSSFSIP QPRYLLTQHH QPYNMYNNNS LSMINRRSSD GTFVNPGPSS SFPGFGYDMS  360
QASTSTSSSI RDHGLLQDIL PSQIRSDTIN TQTNEENKK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-272132801077Probable WRKY transcription factor 4
2lex_A1e-272132801077Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.271700.0flower| leaf| root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible248611_at0.0
Expression AtlasAT5G49520-
AtGenExpressAT5G49520-
ATTED-IIAT5G49520-
Functional Description ? help Back to Top
Source Description
TAIREncodes WRKY48, a member of the WRKY Transcription Factor. WRKY48 is a stress- and pathogen-induced transcriptional activator that represses plant basal defense.
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. WRKY48 is a negative regulator of Pseudomonas Sryngae (a bacterial pathogen), growth in Arabidopsis.
    [PMID: 19825553]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G49520.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G49520
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4423970.0AF442397.1 Arabidopsis thaliana WRKY transcription factor 48 (WRKY48) mRNA, complete cds.
GenBankAY0638700.0AY063870.1 Arabidopsis thaliana unknown protein (At5g49520) mRNA, complete cds.
GenBankAY0912240.0AY091224.1 Arabidopsis thaliana unknown protein (At5g49520) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_199763.10.0putative WRKY transcription factor 48
SwissprotQ9FGZ40.0WRK48_ARATH; Probable WRKY transcription factor 48
TrEMBLD7MNT30.0D7MNT3_ARALL; Putative uncharacterized protein
STRINGAT5G49520.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56242648
Representative plantOGRP1417875
Publications ? help Back to Top
  1. Eulgem T,Rushton PJ,Robatzek S,Somssich IE
    The WRKY superfamily of plant transcription factors.
    Trends Plant Sci., 2000. 5(5): p. 199-206
    [PMID:10785665]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Vanderauwera S, et al.
    Genome-wide analysis of hydrogen peroxide-regulated gene expression in Arabidopsis reveals a high light-induced transcriptional cluster involved in anthocyanin biosynthesis.
    Plant Physiol., 2005. 139(2): p. 806-21
    [PMID:16183842]
  5. Ma S,Gong Q,Bohnert HJ
    Dissecting salt stress pathways.
    J. Exp. Bot., 2006. 57(5): p. 1097-107
    [PMID:16510518]
  6. Qutob D, et al.
    Phytotoxicity and innate immune responses induced by Nep1-like proteins.
    Plant Cell, 2006. 18(12): p. 3721-44
    [PMID:17194768]
  7. Lee J, et al.
    Analysis of transcription factor HY5 genomic binding sites revealed its hierarchical role in light regulation of development.
    Plant Cell, 2007. 19(3): p. 731-49
    [PMID:17337630]
  8. Libault M,Wan J,Czechowski T,Udvardi M,Stacey G
    Identification of 118 Arabidopsis transcription factor and 30 ubiquitin-ligase genes responding to chitin, a plant-defense elicitor.
    Mol. Plant Microbe Interact., 2007. 20(8): p. 900-11
    [PMID:17722694]
  9. Kim KC,Lai Z,Fan B,Chen Z
    Arabidopsis WRKY38 and WRKY62 transcription factors interact with histone deacetylase 19 in basal defense.
    Plant Cell, 2008. 20(9): p. 2357-71
    [PMID:18776063]
  10. Xing DH, et al.
    Stress- and pathogen-induced Arabidopsis WRKY48 is a transcriptional activator that represses plant basal defense.
    Mol Plant, 2008. 1(3): p. 459-70
    [PMID:19825553]
  11. Gao X,He P
    Nuclear dynamics of Arabidopsis calcium-dependent protein kinases in effector-triggered immunity.
    Plant Signal Behav, 2013. 8(4): p. e23868
    [PMID:23425856]